USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Default DefaultDefault DefaultDefault DefaultDefault DefaultDefault Default
0 items
New Products
Product Details
Nike Stamped Swoosh Logo Futura Tee White 3XLT
Nike Stamped Swoosh Logo Futura Tee White 3XLT
Nike Stamped Swoosh Logo Futura Tee White 3XLT
Nike Stamped Swoosh Logo Futura Tee White 3XLT
Notify me when product is back in stock
Product Code:DJ8495
Product Condition:New
$24.99 inc. tax
Add to Cart
Description
What sets the Nike Sole Swoosh logo tee apart from all the others? Room, comfort and athletic fit!! Large old-school Sole Stamped Swoosh logo on the front, simple crew-neck style, Dri-Fit to help you stay cool and dry!

Measurements: 30" chest, 35" length. Fabric: 65% cotton, 35% polyester, machine washable.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i