Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Default DefaultDefault DefaultDefault DefaultDefault DefaultDefault Default
0 items
New Products
NIKE 4XLT TEES
  • sort by
    • Nike Classic Screen Swoosh D..
    Add To Cart
    Nike Classic Screen Swoosh D..
    Athletic cut and style are always a perfect fit with the Nike Screen Swoosh Dri-Fit Tee. This lightweight short sleeve tee shows off the classic Swoosh logo in screen-printed black contrast style. The athletic cut makes it a great tee for working out. Measurements: 31" chest, 37" length. Fabric: 60%...
    $28.99
    Details Add To Cart
    Nike Classic Screen Swoosh D..
    Add To Cart
    Nike Classic Screen Swoosh D..
    Athletic cut and style are always a perfect fit with the Nike Screen Swoosh Dri-Fit Tee. This lightweight short sleeve tee shows off the classic Swoosh logo in screen-printed black contrast style. The athletic cut makes it a great tee for working out. Measurements: 31" chest, 37" length. Fabric: 60%...
    $28.99
    Details Add To Cart
    2 product(s) found for "NIKE 4XLT TEES"
    Create a free online store
    Powered by freewebstore
    Get your free online store today - Be your own boss!
    freewebstore
    Got a great business idea?
    Get a free online store just like this one!
    What do I get?
    Full eCommerce store
    Free hosting
    Unlimited products
    Domain & Free SSL
    checkout
    24/7 support
    And more...
    Why freewebstore?
    20+ years
    1M+ stores created
    No payment required
    Easy to create
    What's the catch?
    Nope, no catch
    0% commission
    Free forever!
    Premium upgrades available
    Get Started
    i