USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Default DefaultDefault DefaultDefault DefaultDefault DefaultDefault Default
0 items
New Products
Product Details
Nike Futura JDI Just Do It Logo T-Shirt Orange 4XL
Nike Futura JDI Just Do It Logo T-Shirt Orange 4XL
Nike Futura JDI Just Do It Logo T-Shirt Orange 4XL
Nike Futura JDI Just Do It Logo T-Shirt Orange 4XL
Notify me when product is back in stock
Brand:Nike
Product Code:550512
Product Condition:New
$26.99 inc. tax
Add to Cart
Description
This Nike Tee will become your favorite drill-and-play basic, with a crew tagless neckline, athletic fit and short sleeves. Large NIKE screen print Futura logo front. Perfect tee to sporty while cheering on your Tennessee Vols!!! 

Measurements: 31" chest, 34" length. Fabric: 100% cotton, machine washable.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i